DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and C02F12.5

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:55 Identity:16/55 - (29%)
Similarity:20/55 - (36%) Gaps:2/55 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CGEE--FGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEEKCK 78
            |..|  ||...:.......|.|......|:.:.|.||...:|.|.....|.|.||
 Worm    21 CSSELKFGTACSENKTSTKWYYDSKLLFCYPYKYLGCGEGSNSFESNENCLESCK 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 10/44 (23%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 10/39 (26%)

Return to query results.
Submit another query.