DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and F30H5.3

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_497206.1 Gene:F30H5.3 / 175207 WormBaseID:WBGene00017937 Length:1599 Species:Caenorhabditis elegans


Alignment Length:70 Identity:24/70 - (34%)
Similarity:35/70 - (50%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ICCLVASAFATLKNPICGEEFGVKGTCR-SLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLEC 73
            :||....|       ||.:...: |.|: |::..| |...|..|..|:|:||.||:|.|...|||
 Worm   554 VCCPRPQA-------ICSQPLRL-GDCKQSVRRYW-YNAVTRACEIFDYTGCQGNDNNFETLLEC 609

  Fly    74 EEKCK 78
            :..|:
 Worm   610 QNTCE 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 18/45 (40%)
F30H5.3NP_497206.1 EB 135..182 CDD:460294
KU 330..391 CDD:197529
KU <481..516 CDD:197529
Kunitz_BPTI 562..613 CDD:425421 20/52 (38%)
Kunitz_BPTI 669..723 CDD:425421
Kunitz_BPTI 776..829 CDD:425421
Lustrin_cystein 834..879 CDD:464222
Lustrin_cystein 885..930 CDD:464222
Lustrin_cystein 1105..1150 CDD:464222
EB 1212..1263 CDD:460294
EB 1267..1318 CDD:460294
Lustrin_cystein 1466..1511 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.