DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and axo

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_061506652.1 Gene:axo / 1277107 VectorBaseID:AGAMI1_007650 Length:2097 Species:Anopheles gambiae


Alignment Length:48 Identity:14/48 - (29%)
Similarity:22/48 - (45%) Gaps:1/48 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGN-NNLFHKKLECEEKC 77
            |..|.|::....:.:....|.|..|.:.||.|| .|.|....:|.::|
Mosquito    47 GEPGQCQTFDYRYRFEQTINNCTQFIWGGCGGNLQNNFETYEQCMQQC 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 12/45 (27%)
axoXP_061506652.1 None

Return to query results.
Submit another query.