DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and Ambp

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:69 Identity:22/69 - (31%)
Similarity:32/69 - (46%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLECEE 75
            |.......|....||      |:|.||:...:|.:.....:|..|:|.||.||.|.|:.:.||:|
Mouse   276 CLQTCRTIAACNLPI------VQGPCRAFIKLWAFDAAQGKCIQFHYGGCKGNGNKFYSEKECKE 334

  Fly    76 KCKI 79
            .|.:
Mouse   335 YCGV 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/44 (39%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639 1/4 (25%)
Kunitz_bikunin_2-like 284..337 CDD:438640 20/58 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.