DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16704 and EPPIN-WFDC6

DIOPT Version :10

Sequence 1:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001185915.1 Gene:EPPIN-WFDC6 / 100526773 HGNCID:38825 Length:179 Species:Homo sapiens


Alignment Length:70 Identity:25/70 - (35%)
Similarity:29/70 - (41%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CCLVA--SAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTNECFTFNYSGCHGNNNLFHKKLEC 73
            ||:.:  .....||..:| |.....|.|.:....|.|....|.|..|.|.||.||||.|..|..|
Human    60 CCVFSCGKKCLDLKQDVC-EMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANC 123

  Fly    74 EEKCK 78
            ...||
Human   124 LNTCK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 17/44 (39%)
EPPIN-WFDC6NP_001185915.1 Kunitz_eppin 75..131 CDD:438654 21/55 (38%)

Return to query results.
Submit another query.