DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and WFDC8

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_016883608.1 Gene:WFDC8 / 90199 HGNCID:16163 Length:247 Species:Homo sapiens


Alignment Length:81 Identity:21/81 - (25%)
Similarity:26/81 - (32%) Gaps:19/81 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 PYDARIYDSTMCSSS------PVGQGTCLGDAGSPLI---HGAELHGIVS--WGIPC------GE 240
            ||| ..::...|...      .|..|..||....|.:   ...||.|:..  .|.||      .|
Human   216 PYD-EDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLPEE 279

  Fly   241 GYPD-VYARISSHRGW 255
            |.|. ||......:.|
Human   280 GSPGAVYLLSKQGKSW 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633
WFDC8XP_016883608.1 WAP 47..90 CDD:459672
KU 93..145 CDD:197529
WAP 150..190 CDD:459672
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.