DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and TFPI2

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_006519.1 Gene:TFPI2 / 7980 HGNCID:11761 Length:235 Species:Homo sapiens


Alignment Length:56 Identity:23/56 - (41%)
Similarity:35/56 - (62%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRLR 96
            |..||..|||..:..||.:|.:...|::|.||||...:|||::.|:|:|.|.:.|:
Human   158 CYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 21/49 (43%)
TFPI2NP_006519.1 Kunitz_TFPI2_1-like 32..88 CDD:438659
Kunitz_BPTI 95..149 CDD:425421
Kunitz_TFPI1_TFPI2_3-like 155..204 CDD:438658 19/45 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.