DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and TFPI

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_006278.1 Gene:TFPI / 7035 HGNCID:11760 Length:304 Species:Homo sapiens


Alignment Length:62 Identity:28/62 - (45%)
Similarity:35/62 - (56%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QTHEQIEQIIACRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            :|..|.|:...|...:.||:|||:..||.||.:|..||.|.|.||....|||.|.|||:..|
Human   114 KTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 24/49 (49%)
TFPINP_006278.1 Kunitz_TFPI1_1-like 51..105 CDD:438656
Kunitz_TFPI1_2-like 121..176 CDD:438657 25/55 (45%)
Kunitz_TFPI1_TFPI2_3-like 214..267 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.