DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:54 Identity:20/54 - (37%)
Similarity:27/54 - (50%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQR 94
            |..|:..|.|..:..|:.||:.||.|..|||.||....|||.:...|...|.::
  Rat    87 CSLPQDAGPCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVCKKK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 19/49 (39%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:459672
Kunitz_eppin 85..141 CDD:438654 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.