DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Spint3

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:51 Identity:24/51 - (47%)
Similarity:29/51 - (56%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            |..||..|.||...:|:.||.|||.||.|.|.||...||||.:..:|:..|
Mouse    35 CILPKDIGGCRAVFVRWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 23/49 (47%)
Spint3NP_001170872.1 Kunitz_actitoxin-like 31..85 CDD:438676 23/49 (47%)

Return to query results.
Submit another query.