DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and spint2

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:52 Identity:23/52 - (44%)
Similarity:28/52 - (53%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCM 92
            ||.|.|.|.||....|:.|:.....|:||||.||...||||.:..||...|:
Zfish   133 CRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASCL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 22/49 (45%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633 22/49 (45%)
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.