DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and tfpi2

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001035185.1 Gene:tfpi2 / 560339 ZFINID:ZDB-GENE-060503-38 Length:233 Species:Danio rerio


Alignment Length:79 Identity:27/79 - (34%)
Similarity:33/79 - (41%) Gaps:10/79 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLPSLENQTHEQIEQIIACRQPKA----------PGLCRGHQLRYAYNKKTGNCESFIYTGCAST 77
            |....||......|.|..|:.||.          .|.|.....||.||..|..||.|:||||..:
Zfish   122 GCQGNENNFRNPEECIEYCKPPKTIPVICLDNLDKGRCSASIPRYYYNSATKTCEEFMYTGCGGS 186

  Fly    78 ENNFLTFEECRRDC 91
            .|||::.:.|...|
Zfish   187 NNNFISKQSCVDVC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 21/59 (36%)
tfpi2NP_001035185.1 Kunitz-type 30..80 CDD:438633
Kunitz_TFPI2_2-like 87..140 CDD:438660 5/17 (29%)
Kunitz_TFPI1_TFPI2_3-like 147..200 CDD:438658 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.