DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and tfpi2

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001015766.1 Gene:tfpi2 / 548483 XenbaseID:XB-GENE-1002090 Length:219 Species:Xenopus tropicalis


Alignment Length:55 Identity:25/55 - (45%)
Similarity:27/55 - (49%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ACRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQR 94
            |||.....|.|||...|||||.:|..||.|.|.||...:|||.....|...|..|
 Frog    88 ACRMDPDEGPCRGFLKRYAYNMQTMKCEQFYYGGCYGNDNNFKDKASCMDFCSPR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 22/49 (45%)
tfpi2NP_001015766.1 Kunitz_TFPI2_1-like 25..81 CDD:438659
Kunitz_TFPI2_2-like 86..139 CDD:438660 23/50 (46%)
Kunitz_TFPI1_TFPI2_3-like 146..199 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.