DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and CG17380

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:77 Identity:26/77 - (33%)
Similarity:35/77 - (45%) Gaps:12/77 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WLVLLLVVGLSLGLPSLENQTHEQIEQIIACRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCA 75
            :|:.|:|.|.|..|      .||:      |.....||.|:|:...:||:.....|..|||.||.
  Fly     7 FLIFLIVPGTSTAL------RHER------CSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCG 59

  Fly    76 STENNFLTFEEC 87
            ...|.|.|.:||
  Fly    60 GNPNRFQTKKEC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 18/47 (38%)
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 18/47 (38%)

Return to query results.
Submit another query.