DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and CG34276

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:84 Identity:25/84 - (29%)
Similarity:39/84 - (46%) Gaps:11/84 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLLLVVGLSLGLPSLENQTHEQIEQIIACRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCAS 76
            |::|||..|         |....|::  .|.||...|..:.:...:.||..:..|:.||:.|.||
  Fly     8 LLILLVFCL---------QQSYSIKR--RCLQPLDVGKGKAYLRNWFYNSTSQRCQRFIFYGGAS 61

  Fly    77 TENNFLTFEECRRDCMQRL 95
            ..|||.|...|.:.|:.::
  Fly    62 NGNNFNTQARCHKICLAQV 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 17/49 (35%)
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/49 (35%)

Return to query results.
Submit another query.