DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and CG13748

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_610430.1 Gene:CG13748 / 35896 FlyBaseID:FBgn0033355 Length:113 Species:Drosophila melanogaster


Alignment Length:102 Identity:27/102 - (26%)
Similarity:43/102 - (42%) Gaps:26/102 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LVLLLVVGL-------------------SLGLPSLEN---QTHEQIEQIIACRQPKAPGLCRGHQ 54
            :||:|:.|:                   ::.|..:.|   .||.  ||.  |..|...|:||...
  Fly    13 VVLILLAGIRWSEAFPMDLYDDVSDFFDAISLDDVANTGRNTHP--EQF--CLMPARKGVCRALI 73

  Fly    55 LRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            .|:.|:.:...|..|.:.||...||||.::::|...|
  Fly    74 PRWRYDPEQKKCVEFKFGGCDGNENNFASYKDCMSTC 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 16/49 (33%)
CG13748NP_610430.1 Kunitz-type 57..112 CDD:444694 19/56 (34%)

Return to query results.
Submit another query.