DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and CG3513

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster


Alignment Length:83 Identity:20/83 - (24%)
Similarity:29/83 - (34%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LVVGLSLGLPSLENQTHEQIEQIIACRQPKA-------PGLCRGHQLRYAYNKKTGNCESFIYTG 73
            :.:...|.|.......|.:.|.   |:||.:       ...|......:.|:.....|..||:.|
  Fly     7 VAIAFLLSLSGSRLWVHAKPEM---CQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGG 68

  Fly    74 CASTENNFLTFEECRRDC 91
            |....|.|.|..||.:.|
  Fly    69 CGGNSNQFSTKSECEKAC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 15/56 (27%)
CG3513NP_608798.1 Kunitz_SCI-I-like 28..86 CDD:438677 15/60 (25%)

Return to query results.
Submit another query.