DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Tfpi

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:XP_008760202.1 Gene:Tfpi / 29436 RGDID:61914 Length:306 Species:Rattus norvegicus


Alignment Length:51 Identity:25/51 - (49%)
Similarity:29/51 - (56%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            |...:.||:|||...||.||.::..||.|.|.||....|||.|.||||..|
  Rat   124 CFLEEDPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTC 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 24/49 (49%)
TfpiXP_008760202.1 Kunitz_TFPI1_1-like 50..104 CDD:438656
Kunitz_TFPI1_2-like 120..175 CDD:438657 25/51 (49%)
Kunitz_TFPI1_TFPI2_3-like 223..276 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.