DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Tfpi2

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_775164.2 Gene:Tfpi2 / 286926 RGDID:628629 Length:230 Species:Rattus norvegicus


Alignment Length:56 Identity:24/56 - (42%)
Similarity:32/56 - (57%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDCMQRLR 96
            |..||..|||..:..||.:|.:...||:|.||||...||||...:.|.|.|::.|:
  Rat   156 CSSPKDEGLCSANVTRYYFNSRNKACETFTYTGCGGNENNFYYLDACNRACVKALK 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 22/49 (45%)
Tfpi2NP_775164.2 Kunitz-type 32..87 CDD:444694
Kunitz-type 93..146 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 153..206 CDD:438658 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.