DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Wfdc8

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001263361.1 Gene:Wfdc8 / 277343 MGIID:2685552 Length:426 Species:Mus musculus


Alignment Length:131 Identity:32/131 - (24%)
Similarity:47/131 - (35%) Gaps:43/131 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SSWGQLWLVLLLVVGLSLGLPS------LENQTHEQIEQIIACRQ-------------------- 43
            |.|....|:|||.:.|||...|      ::.:..|...|.:.||.                    
Mouse    48 SWWSGALLLLLLFLFLSLEQTSTSYNAKIKQKVGECPRQRLECRNESLSSCKTDFNCKAHFKCCQ 112

  Fly    44 -----------------PKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
                             |...|.|:....|:.::.:...|.:|:|:||....|||||..:||..|
Mouse   113 FACGRKCMDPYEEPCMLPSDKGNCQDILTRWYFDSQKHQCRAFLYSGCRGNANNFLTKTDCRNAC 177

  Fly    92 M 92
            |
Mouse   178 M 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 18/86 (21%)
Wfdc8NP_001263361.1 WAP 79..122 CDD:459672 4/42 (10%)
Kunitz-type 127..177 CDD:438633 16/49 (33%)
WAP <180..222 CDD:238120
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.