DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and AMBP

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:52 Identity:21/52 - (40%)
Similarity:29/52 - (55%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ACRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            :|:...:.|.|.|...||.||..:..||:|.|.||....|||:|.:||.:.|
Human   230 SCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 20/49 (41%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639 21/52 (40%)
Kunitz_bikunin_2-like 284..338 CDD:438640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.