DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Spint1

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_058603.2 Gene:Spint1 / 20732 MGIID:1338033 Length:507 Species:Mus musculus


Alignment Length:118 Identity:30/118 - (25%)
Similarity:50/118 - (42%) Gaps:37/118 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 SQGGFNLGLRRIVIHPNFAS-ATLANDVAVARV----------AQQMVLSDAVQ--GVQLGSYNI 148
            |.|||:..|..::..|.:.| |..|:::.:.|:          .:..:|.|.||  .:|:..|..
Mouse   228 SDGGFSRRLEPVISEPIYDSKAPNASNLKIVRMDRTAGCVTGGEEVYLLCDKVQKDDIQVRFYED 292

  Fly   149 N----VAYG-----------ALVSGWGRTEFSNPQFPD-NLQYIAVNVISQLE 185
            :    .|||           |:|       |..|::.| |||. .::|..||:
Mouse   293 DDSGWEAYGDFSPTDVHRQFAIV-------FKTPKYRDLNLQK-PISVFVQLK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633
Spint1NP_058603.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666 11/57 (19%)
LDLa 313..344 CDD:197566 11/33 (33%)
Kunitz_HAI1_2-like 369..428 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.