DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and ZK287.4

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:79 Identity:24/79 - (30%)
Similarity:35/79 - (44%) Gaps:14/79 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PSLENQTHEQIEQII------------ACRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCAST 77
            |:..:|..||...::            .|.||...|.....:.|:||:  .|.|.||:|:|....
 Worm   967 PAQVSQPQEQSSNMVIDFVPATHASNNLCGQPIDVGFGVLSEHRWAYS--AGQCTSFLYSGHGGN 1029

  Fly    78 ENNFLTFEECRRDC 91
            .|||||..:|.:.|
 Worm  1030 MNNFLTRNDCMKTC 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 19/49 (39%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636
KU 318..368 CDD:197529
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636 19/49 (39%)
Kunitz_conkunitzin 1054..1104 CDD:438636
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.