DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:68 Identity:20/68 - (29%)
Similarity:35/68 - (51%) Gaps:13/68 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IEQIIACRQP---------KAPGLCRG--HQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECR 88
            :.::::..||         |.|  |:.  .::||.:::|:....:|.|:||...:|||.|..|||
 Worm    14 VSELVSTLQPECKLPLDMGKTP--CKNGKKEIRYHFDQKSNIPLAFEYSGCGGNKNNFKTESECR 76

  Fly    89 RDC 91
            ..|
 Worm    77 FTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 19/60 (32%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 17/55 (31%)

Return to query results.
Submit another query.