DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and K10D3.4

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:51 Identity:24/51 - (47%)
Similarity:33/51 - (64%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            |:.|:..|.|..:..|:.:|.||||||.|||:||....|||.|::||:..|
 Worm   411 CKLPREQGNCGTYSNRWWFNAKTGNCEEFIYSGCQGNANNFETYKECQDYC 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 23/49 (47%)
K10D3.4NP_492020.1 EB 46..100 CDD:460294
Kunitz_BPTI 170..226 CDD:425421
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:425421 24/51 (47%)
Kunitz_BPTI 518..571 CDD:425421
Kunitz_BPTI 628..681 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.