DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and SPINT3

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:85 Identity:30/85 - (35%)
Similarity:43/85 - (50%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLWLVLLLVVGLSLGLPSLENQTHEQIEQII--ACRQPKAPGLCRGHQLRYAYNKKTGNCESFIY 71
            |..|..||::.|.|.|.|  ....:.|:.::  .|..|...|.|:.:..|:.:|.:||.||.|.|
Human     4 QASLSFLLILTLCLELRS--ELARDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAY 66

  Fly    72 TGCASTENNFLTFEECRRDC 91
            .||....||||..|:|.:.|
Human    67 GGCGGNSNNFLRKEKCEKFC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 20/49 (41%)
SPINT3NP_006643.1 Kunitz_BPTI 35..87 CDD:425421 21/52 (40%)

Return to query results.
Submit another query.