DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and SPINT2

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_066925.1 Gene:SPINT2 / 10653 HGNCID:11247 Length:252 Species:Homo sapiens


Alignment Length:51 Identity:22/51 - (43%)
Similarity:28/51 - (54%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTENNFLTFEECRRDC 91
            |...|..|.||....|:.||...|:|:.|:|.||....||:||.|||.:.|
Human    38 CLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKC 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 21/49 (43%)
SPINT2NP_066925.1 Kunitz_HAI2_1-like 36..88 CDD:438664 21/49 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..122
Kunitz_HAI2_2-like 131..183 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.