DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15418 and CG42828

DIOPT Version :10

Sequence 1:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001189271.1 Gene:CG42828 / 10178934 FlyBaseID:FBgn0262010 Length:89 Species:Drosophila melanogaster


Alignment Length:78 Identity:27/78 - (34%)
Similarity:37/78 - (47%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLVVGLSLGLPSLENQTHEQIEQIIA-CRQPKAPGLCRGHQLRYAYNKKTGNCESFIYTGCASTE 78
            ||.|.||         |.|..|:..| |..|...|.|.||::.:|::.|...|..|:::.|...|
  Fly    10 LLAVLLS---------TVESAEKRKAFCYLPYEFGKCGGHRIMWAFSNKEQECVPFVFSNCGGNE 65

  Fly    79 NNFLTFEECRRDC 91
            |.|.|.|.|.:.|
  Fly    66 NRFYTKENCEKAC 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 17/49 (35%)
CG42828NP_001189271.1 KU 27..78 CDD:197529 17/50 (34%)

Return to query results.
Submit another query.