DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and CMR3

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_015338.1 Gene:CMR3 / 856123 SGDID:S000006217 Length:317 Species:Saccharomyces cerevisiae


Alignment Length:383 Identity:75/383 - (19%)
Similarity:120/383 - (31%) Gaps:161/383 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ITVDDELNLSREQDFAEEDFIVIKEERE------------TSLSPML---TPPHTPT--EEPLRR 59
            ::..|:|:..:...|...:  ..|.|||            :||.|..   |||:..:  :.|.::
Yeast    40 VSAVDQLSTGKGTQFYGHN--SYKNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQ 102

  Fly    60 VHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHRLWLQMQQQQQQHQAPQQYPVYPTASADPV 124
            |:.:::...:..:::                           .....:....|||:|.|.|..|:
Yeast   103 VYQSMNVVPIVNEIY---------------------------TPISMNATSDQYPIYYTESQQPI 140

  Fly   125 AVHQQLMNHWIRNA---------AIYQQQQQQQQHPHHHHHHGHPHHPHP--------------- 165
            . |.| ..|...:|         .:|:...              |:...|               
Yeast   141 P-HSQ-SPHLTSSAPLMMPVMVPTVYKPLT--------------PYDKEPITIASEPNFTAISMA 189

  Fly   166 -HPH------HVRP--YPAGLHSLHAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSRPKKQFI 221
             ||:      |.||  .|.|            :|.:||::....|.....|......|.....: 
Yeast   190 SHPNAALELCHDRPKSVPPG------------YGVLPTMQEASNGRTKSEPGAVLNGSATFSDW- 241

  Fly   222 CKYCNRQFTKSYNLLIHERTHTDERPYS------CDICGKAFRRQDHLRDHRYIHSKDKPFKCSD 280
                                .||.|..|      |.:|||...|...|:.|..||:.|.||||: 
Yeast   242 --------------------KTDTRISSTKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCT- 285

  Fly   281 CGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTKEVVVTT 338
                               .||      |.:|||.::|:..||:|| |:...:|:.||
Yeast   286 -------------------WEG------CTKSFNVKSNMLRHLKSH-ERKRNKVLNTT 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 32/136 (24%)
C2H2 Zn finger 222..242 CDD:275368 0/19 (0%)
zf-H2C2_2 234..259 CDD:290200 8/30 (27%)
C2H2 Zn finger 250..270 CDD:275368 7/19 (37%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 1/19 (5%)
zf-C2H2 304..326 CDD:278523 7/21 (33%)
C2H2 Zn finger 306..326 CDD:275368 7/19 (37%)
CMR3NP_015338.1 COG5048 17..316 CDD:227381 73/380 (19%)
C2H2 Zn finger 256..276 CDD:275370 7/19 (37%)
C2H2 Zn finger 284..306 CDD:275370 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.