DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and CRZ1

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:122 Identity:42/122 - (34%)
Similarity:62/122 - (50%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TGSSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKDKP 275
            |.:.:....|.|..|.::||:.|||..|.||||:|||:.|.||||||.||...:.|..:|:..|.
Yeast   560 TNNRKNPANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKR 624

  Fly   276 FKCS---------DCGKGFCQSRTLAVHKVTHLEEGPHKC--PICQRSFNQRANLKS 321
            :.|.         .|||.|.:|..|..|..|   |...:|  |:.:.:..:::..:|
Yeast   625 YVCGGKLKDGKPWGCGKKFARSDALGRHFKT---ESGRRCITPLYEEARQEKSGQES 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 42/122 (34%)
C2H2 Zn finger 222..242 CDD:275368 9/19 (47%)
zf-H2C2_2 234..259 CDD:290200 17/24 (71%)
C2H2 Zn finger 250..270 CDD:275368 10/19 (53%)
zf-H2C2_2 262..285 CDD:290200 7/31 (23%)
C2H2 Zn finger 278..298 CDD:275368 8/28 (29%)
zf-C2H2 304..326 CDD:278523 3/20 (15%)
C2H2 Zn finger 306..326 CDD:275368 3/18 (17%)
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 27/56 (48%)
C2H2 Zn finger 571..591 CDD:275368 9/19 (47%)
C2H2 Zn finger 599..619 CDD:275368 10/19 (53%)
C2H2 Zn finger 627..655 CDD:275368 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2594
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.