DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and FZF1

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_011260.1 Gene:FZF1 / 852638 SGDID:S000003223 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:56/229 - (24%)
Similarity:90/229 - (39%) Gaps:66/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TGSSRPK-KQFICKY--CNRQFTKSYNLLIHERTHTDERPYSCDI--CGKAFRRQDHLRDHRYIH 270
            |...|.| :.:.|.:  |.:.:.:...|..|:.:||:::||.||.  |||.|.|..|||.|::.|
Yeast     2 TDIGRTKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTH 66

  Fly   271 SKDKPFKCSDCGKGFCQSRTLAVHKVTHL--------------------------EEG------P 303
            |:.||..|:.|.|.|..::.|..|..:|.                          :||      |
Yeast    67 SQIKPKACTLCQKRFVTNQQLRRHLNSHERKSKLASRIDRKHEGVNANVKAELNGKEGGFDPKLP 131

  Fly   304 HKCPICQRSFNQ-------------------------RANLKSHLQSHSEQSTKEVVVTTSPATS 343
            ...|:|...|:|                         ..:|.:|:..| ..::|.||.:..|:..
Yeast   132 SGSPMCGEEFSQGHLPGYDDMQVLQCPYKSCQKVTSFNDDLINHMLQH-HIASKLVVPSGDPSLK 195

  Fly   344 HSVPNQALSSPQPENLAQHLPVLDLSSSSSSSEK 377
            .|:|....||...   ...:|.|..|::.:||.:
Yeast   196 ESLPTSEKSSSTD---TTSIPQLSFSTTGTSSSE 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 44/184 (24%)
C2H2 Zn finger 222..242 CDD:275368 4/21 (19%)
zf-H2C2_2 234..259 CDD:290200 12/26 (46%)
C2H2 Zn finger 250..270 CDD:275368 11/21 (52%)
zf-H2C2_2 262..285 CDD:290200 11/22 (50%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-C2H2 304..326 CDD:278523 6/46 (13%)
C2H2 Zn finger 306..326 CDD:275368 6/44 (14%)
FZF1NP_011260.1 COG5048 15..297 CDD:227381 52/216 (24%)
C2H2 Zn finger 17..36 CDD:275368 3/18 (17%)
C2H2 Zn finger 44..66 CDD:275368 11/21 (52%)
C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.