Sequence 1: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003588.1 | Gene: | KLF11 / 8462 | HGNCID: | 11811 | Length: | 512 | Species: | Homo sapiens |
Alignment Length: | 236 | Identity: | 60/236 - (25%) |
---|---|---|---|
Similarity: | 93/236 - (39%) | Gaps: | 72/236 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 PHPHPHHVRP-YPAGLHSLHAAVMGRHFGAMP-----TLKLGGAGGASGVPSG-----ATGS--- 213
Fly 214 ------SRPKKQFICKY--CNRQFTKSYNLLIHERTHTDERPYSC--DICGKAFRRQDHLRDHRY 268
Fly 269 IHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTKE 333
Fly 334 VVVTTSPATSHSVP--NQALSSPQPENLAQHLPVLDLSSSS 372 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 40/148 (27%) |
C2H2 Zn finger | 222..242 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 234..259 | CDD:290200 | 13/26 (50%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 262..285 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 0/19 (0%) | ||
zf-C2H2 | 304..326 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 306..326 | CDD:275368 | 7/19 (37%) | ||
KLF11 | NP_003588.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 109..128 | ||
COG5048 | 393..>449 | CDD:227381 | 22/55 (40%) | ||
zf-C2H2 | 394..418 | CDD:278523 | 7/23 (30%) | ||
C2H2 Zn finger | 399..418 | CDD:275368 | 6/18 (33%) | ||
zf-H2C2_2 | 410..437 | CDD:290200 | 13/26 (50%) | ||
C2H2 Zn finger | 426..448 | CDD:275368 | 10/21 (48%) | ||
zf-H2C2_2 | 440..463 | CDD:290200 | 10/50 (20%) | ||
zf-C2H2 | 454..476 | CDD:278523 | 8/49 (16%) | ||
C2H2 Zn finger | 456..476 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |