DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and AT5G60470

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001331895.1 Gene:AT5G60470 / 836168 AraportID:AT5G60470 Length:459 Species:Arabidopsis thaliana


Alignment Length:294 Identity:57/294 - (19%)
Similarity:96/294 - (32%) Gaps:80/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 QQQQHPHHHHHHGHPHHPHPHPHHV-RPYPAGLHSLHAAVMGRHFGAMPTLKLGGAGGASGVPSG 209
            |....||:|.........|...|.. .|||   :|..||..     ..|..|....|...  |:.
plant     3 QDMMIPHNHDRLSFSSFVHDQEHITPNPYP---NSQPAAST-----KTPKKKRNLPGNPD--PNA 57

  Fly   210 ATGSSRPK-----KQFICKYCNRQFTKSYNLLIHERTHT-------------------------- 243
            ...|..||     .:|.|:.||:.|.:..||.:|:|.|.                          
plant    58 EVISLSPKSLMATNRFFCEICNKGFQREQNLQLHKRGHNLPWKLKQKTNKNQVKKKVYICPEKSC 122

  Fly   244 -----------------------DERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGF 285
                                   .|:.:.||.|.|.:......:.|..| ...:.|:| |||..|
plant   123 VHHDPARALGDLTGIKKHFSRKHGEKKWKCDKCSKKYAVISDWKAHNKI-CGSREFRC-DCGTLF 185

  Fly   286 CQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTKEVVVTTSPATSHSVPNQA 350
            .:..:...|:        ..|.:.....::..::.|.|.::|..:|  |..|.:|....|..:|:
plant   186 SRKDSFISHR--------SFCDVLAEESSKFFSVPSPLAANSTIAT--VTDTNNPILIQSQLDQS 240

  Fly   351 LSSPQPENLAQHLPVL---DLSSSSSSSEKPKRM 381
            .:.....|:..:...|   ..::|:.:.::|..:
plant   241 STGTADLNVNNNHTTLFGQKFTNSNPTQQQPNAL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 33/184 (18%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
zf-H2C2_2 234..259 CDD:290200 10/73 (14%)
C2H2 Zn finger 250..270 CDD:275368 5/19 (26%)
zf-H2C2_2 262..285 CDD:290200 7/22 (32%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-C2H2 304..326 CDD:278523 3/21 (14%)
C2H2 Zn finger 306..326 CDD:275368 3/19 (16%)
AT5G60470NP_001331895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.