DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and IDD5

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001324413.1 Gene:IDD5 / 814738 AraportID:AT2G02070 Length:602 Species:Arabidopsis thaliana


Alignment Length:309 Identity:75/309 - (24%)
Similarity:106/309 - (34%) Gaps:105/309 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 AAIYQQQQQQQQH--PHHHHHHGHPHH-----PHPHPHHVRPYPAGLHSLHAAVMGRHFGAMPTL 195
            |:.:..:|..|.|  |        |:.     |.|.|||..|.|.             ..|.|..
plant     9 ASFFGVRQDDQSHLLP--------PNSSAAAPPPPPPHHQAPLPP-------------LEAPPQK 52

  Fly   196 KLGGAGGASGVPSGATGSSRPK-----KQFICKYCNRQFTKSYNLLIHERTH----------TDE 245
            |...........:.....| ||     .:|||:.||:.|.:..||.:|.|.|          |.|
plant    53 KKRNQPRTPNSDAEVIALS-PKTLMATNRFICEVCNKGFQREQNLQLHRRGHNLPWKLKQKSTKE 116

  Fly   246 ---RPYSC---------------DICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFC-QSRTL 291
               :.|.|               |:.|        ::.|.|....:|.:||..|.|.:. ||...
plant   117 VKRKVYLCPEPSCVHHDPSRALGDLTG--------IKKHYYRKHGEKKWKCDKCSKRYAVQSDWK 173

  Fly   292 AVHKVTHLEEGPHKCPICQRSFNQRANLKSH---LQSHSEQSTKEVVVTTSPATSHSVP------ 347
            |..|....:|  ::|. |...|::|.:..:|   ..:.:::|.:.....|| ..||..|      
plant   174 AHSKTCGTKE--YRCD-CGTLFSRRDSFITHRAFCDALAQESARHPTSLTS-LPSHHFPYGQNTN 234

  Fly   348 ---NQALS-------SPQPENLAQHLP--VLDLSS--------SSSSSE 376
               |.|.|       ...|:|| .|.|  ||.|.|        |.|||:
plant   235 NSNNNASSMILGLSHMGAPQNL-DHQPGDVLRLGSGGGGGGAASRSSSD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 38/167 (23%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
zf-H2C2_2 234..259 CDD:290200 11/52 (21%)
C2H2 Zn finger 250..270 CDD:275368 5/34 (15%)
zf-H2C2_2 262..285 CDD:290200 7/22 (32%)
C2H2 Zn finger 278..298 CDD:275368 7/20 (35%)
zf-C2H2 304..326 CDD:278523 5/24 (21%)
C2H2 Zn finger 306..326 CDD:275368 5/22 (23%)
IDD5NP_001324413.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.