DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and egr4

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001107925.1 Gene:egr4 / 795099 ZFINID:ZDB-GENE-080204-90 Length:352 Species:Danio rerio


Alignment Length:137 Identity:44/137 - (32%)
Similarity:67/137 - (48%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 VRPYPAGLHSLHAAVMGRHFG---AMPTLKLGGAGGASGVPSGATGSSRPKKQFIC--KYCNRQF 229
            |.|.|:..:||:.: ....||   |:.:|...........|....|::| :|.|.|  :.|.|:|
Zfish   199 VAPAPSHENSLYIS-FPNAFGLADALDSLLATNTHAQRSKPRARKGAAR-EKPFSCPVESCERRF 261

  Fly   230 TKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVH 294
            ::|..|..|.|.||..:|:.|.:|.:.|.|.|||..|...|:.:|||.|..|.:.|.:|.....|
Zfish   262 SRSDELNRHVRIHTGHKPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRH 326

  Fly   295 KVTHLEE 301
            ...||::
Zfish   327 MRVHLKQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 35/101 (35%)
C2H2 Zn finger 222..242 CDD:275368 8/21 (38%)
zf-H2C2_2 234..259 CDD:290200 9/24 (38%)
C2H2 Zn finger 250..270 CDD:275368 8/19 (42%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
zf-C2H2 304..326 CDD:278523
C2H2 Zn finger 306..326 CDD:275368
egr4NP_001107925.1 COG5048 229..>311 CDD:227381 28/82 (34%)
C2H2 Zn finger 252..274 CDD:275368 8/21 (38%)
zf-H2C2_2 266..291 CDD:290200 9/24 (38%)
COG5048 278..>344 CDD:227381 20/56 (36%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 294..319 CDD:290200 10/24 (42%)
C2H2 Zn finger 310..330 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.