Sequence 1: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005173612.1 | Gene: | osr2 / 550389 | ZFINID: | ZDB-GENE-050417-183 | Length: | 278 | Species: | Danio rerio |
Alignment Length: | 256 | Identity: | 122/256 - (47%) |
---|---|---|---|
Similarity: | 140/256 - (54%) | Gaps: | 60/256 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 HQAPQ-QYPVYPTASADPVAV---------HQQLMNHWIRNAAIYQQQQQQQQHPHHHHHHGHP- 160
Fly 161 --HH--PHPHPHHVRPYP----AGLHSLHAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSR-- 215
Fly 216 -------------PKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR 267
Fly 268 YIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSE 328 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 94/141 (67%) |
C2H2 Zn finger | 222..242 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 234..259 | CDD:290200 | 22/24 (92%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 18/19 (95%) | ||
zf-H2C2_2 | 262..285 | CDD:290200 | 19/22 (86%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 16/19 (84%) | ||
zf-C2H2 | 304..326 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 306..326 | CDD:275368 | 13/19 (68%) | ||
osr2 | XP_005173612.1 | COG5048 | <55..>276 | CDD:227381 | 108/210 (51%) |
C2H2 Zn finger | 136..156 | CDD:275368 | 15/19 (79%) | ||
zf-H2C2_2 | 148..173 | CDD:290200 | 22/24 (92%) | ||
C2H2 Zn finger | 164..184 | CDD:275368 | 18/19 (95%) | ||
zf-H2C2_2 | 176..199 | CDD:290200 | 19/22 (86%) | ||
C2H2 Zn finger | 192..212 | CDD:275368 | 16/19 (84%) | ||
zf-C2H2 | 218..240 | CDD:278523 | 15/21 (71%) | ||
C2H2 Zn finger | 220..240 | CDD:275368 | 13/19 (68%) | ||
C2H2 Zn finger | 248..268 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 53 | 1.000 | Domainoid score | I11342 |
eggNOG | 1 | 0.900 | - | - | E33208_3B9IA | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000748 | |
OrthoInspector | 1 | 1.000 | - | - | mtm6437 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR14196 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.900 |