DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and osr2

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005173612.1 Gene:osr2 / 550389 ZFINID:ZDB-GENE-050417-183 Length:278 Species:Danio rerio


Alignment Length:256 Identity:122/256 - (47%)
Similarity:140/256 - (54%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 HQAPQ-QYPVYPTASADPVAV---------HQQLMNHWIRNAAIYQQQQQQQQHPHHHHHHGHP- 160
            |.|.| .|.:..|.:|.||||         |...||.|    .:...|.|....|........| 
Zfish    13 HPALQLNYSLLQTLNAFPVAVDQLYGLSALHTVQMNRW----TVGFPQLQGLADPRFPGALPFPA 73

  Fly   161 --HH--PHPHPHHVRPYP----AGLHSLHAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSR-- 215
              .|  ||.||.|.:..|    |.|                      |..|:......||.||  
Zfish    74 AAAHLLPHKHPVHRKDRPRFDFANL----------------------AVAATQEDPPVTGQSRLS 116

  Fly   216 -------------PKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHR 267
                         .||:|||::|.|.||||||||||||||||||||:||||.|||||||||||||
Zfish   117 PERRPARGRLPAKSKKEFICRFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHR 181

  Fly   268 YIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSE 328
            |||||:|||||.:|||||||||||||||..||:|.|||||.|.|:||||:|||:||.:|::
Zfish   182 YIHSKEKPFKCQECGKGFCQSRTLAVHKTLHLQESPHKCPTCGRTFNQRSNLKTHLLTHTD 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 94/141 (67%)
C2H2 Zn finger 222..242 CDD:275368 15/19 (79%)
zf-H2C2_2 234..259 CDD:290200 22/24 (92%)
C2H2 Zn finger 250..270 CDD:275368 18/19 (95%)
zf-H2C2_2 262..285 CDD:290200 19/22 (86%)
C2H2 Zn finger 278..298 CDD:275368 16/19 (84%)
zf-C2H2 304..326 CDD:278523 15/21 (71%)
C2H2 Zn finger 306..326 CDD:275368 13/19 (68%)
osr2XP_005173612.1 COG5048 <55..>276 CDD:227381 108/210 (51%)
C2H2 Zn finger 136..156 CDD:275368 15/19 (79%)
zf-H2C2_2 148..173 CDD:290200 22/24 (92%)
C2H2 Zn finger 164..184 CDD:275368 18/19 (95%)
zf-H2C2_2 176..199 CDD:290200 19/22 (86%)
C2H2 Zn finger 192..212 CDD:275368 16/19 (84%)
zf-C2H2 218..240 CDD:278523 15/21 (71%)
C2H2 Zn finger 220..240 CDD:275368 13/19 (68%)
C2H2 Zn finger 248..268 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11342
eggNOG 1 0.900 - - E33208_3B9IA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm6437
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.