powered by:
Protein Alignment odd and drm
DIOPT Version :9
Sequence 1: | NP_722922.1 |
Gene: | odd / 33583 |
FlyBaseID: | FBgn0002985 |
Length: | 392 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285590.1 |
Gene: | drm / 49638 |
FlyBaseID: | FBgn0024244 |
Length: | 88 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 39/71 - (54%) |
Similarity: | 51/71 - (71%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 215 RPKKQFICKYCNRQFTKSYNLLIHERTH-TDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKC 278
|||.:||||||.|:|||.|||:|||||| :.|..|||::|||.|:::|:||.||.:| .
Fly 21 RPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH-------M 78
Fly 279 SDCGKG 284
..||:|
Fly 79 DTCGRG 84
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000748 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.