DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and drm

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001285590.1 Gene:drm / 49638 FlyBaseID:FBgn0024244 Length:88 Species:Drosophila melanogaster


Alignment Length:71 Identity:39/71 - (54%)
Similarity:51/71 - (71%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 RPKKQFICKYCNRQFTKSYNLLIHERTH-TDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKC 278
            |||.:||||||.|:|||.|||:|||||| :.|..|||::|||.|:::|:||.||.:|       .
  Fly    21 RPKCEFICKYCQRRFTKPYNLMIHERTHKSPEITYSCEVCGKYFKQRDNLRQHRNLH-------M 78

  Fly   279 SDCGKG 284
            ..||:|
  Fly    79 DTCGRG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 39/71 (55%)
C2H2 Zn finger 222..242 CDD:275368 15/19 (79%)
zf-H2C2_2 234..259 CDD:290200 16/25 (64%)
C2H2 Zn finger 250..270 CDD:275368 10/19 (53%)
zf-H2C2_2 262..285 CDD:290200 8/23 (35%)
C2H2 Zn finger 278..298 CDD:275368 3/7 (43%)
zf-C2H2 304..326 CDD:278523
C2H2 Zn finger 306..326 CDD:275368
drmNP_001285590.1 C2H2 Zn finger 28..48 CDD:275368 15/19 (79%)
C2H2 Zn finger 57..77 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.