DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment odd and osr1

DIOPT Version :9

Sequence 1:	NP_722922.1	Gene:	odd / 33583	FlyBaseID:	FBgn0002985	Length:	392	Species:	Drosophila melanogaster
Sequence 2:	NP_001006079.1	Gene:	osr1 / 450059	ZFINID:	ZDB-GENE-070321-1	Length:	264	Species:	Danio rerio

Alignment Length:	94	Identity:	73/94 - (77%)
Similarity:	82/94 - (87%)	Gaps:	0/94 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   207 PSGATGSSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFRRQDHLRDHRYIHS 271
            ||.....|:.||:|:||:|.|.||||||||||||||||||||:||||.|||||||||||||||||
Zfish   161 PSRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHS 225

  Fly   272 KDKPFKCSDCGKGFCQSRTLAVHKVTHLE 300
            |:|||||.:|||||||||||||||..|::
Zfish   226 KEKPFKCQECGKGFCQSRTLAVHKTLHMQ 254

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
odd	NP_722922.1	COG5048	<203..334	CDD:227381	73/94 (78%)
		C2H2 Zn finger	222..242	CDD:275368	16/19 (84%)
		zf-H2C2_2	234..259	CDD:290200	22/24 (92%)
		C2H2 Zn finger	250..270	CDD:275368	18/19 (95%)
		zf-H2C2_2	262..285	CDD:290200	19/22 (86%)
		C2H2 Zn finger	278..298	CDD:275368	16/19 (84%)
		zf-C2H2	304..326	CDD:278523
		C2H2 Zn finger	306..326	CDD:275368
osr1	NP_001006079.1	zf-C2H2	174..196	CDD:278523	17/21 (81%)
		C2H2 Zn finger	176..196	CDD:275368	16/19 (84%)
		zf-H2C2_2	188..213	CDD:290200	22/24 (92%)
		C2H2 Zn finger	204..224	CDD:275368	18/19 (95%)
		zf-H2C2_2	216..239	CDD:290200	19/22 (86%)
		C2H2 Zn finger	232..252	CDD:275368	16/19 (84%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	53	1.000	Domainoid score	I11342
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000748
OrthoInspector	1	1.000	-	-		mtm6437
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR14196
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2698
SonicParanoid	1	1.000	-	-		X1664
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
ZFIN	0	0.000	Not matched by this tool.
	9	9.000