Sequence 1: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262485.1 | Gene: | l(3)neo38 / 41423 | FlyBaseID: | FBgn0265276 | Length: | 455 | Species: | Drosophila melanogaster |
Alignment Length: | 218 | Identity: | 60/218 - (27%) |
---|---|---|---|
Similarity: | 85/218 - (38%) | Gaps: | 38/218 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 HHHGHPHHPHPHPHHVRPYPA-GLHSLHAAVMGRHFGAMPTLKLGGAGGASGV-------PSGAT 211
Fly 212 GSSRPKKQ-----------------------------FICKYCNRQFTKSYNLLIHERTHTDERP 247
Fly 248 YSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRS 312
Fly 313 FNQRANLKSHLQSHSEQSTKEVV 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 44/166 (27%) |
C2H2 Zn finger | 222..242 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 234..259 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 262..285 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2 | 304..326 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 306..326 | CDD:275368 | 5/19 (26%) | ||
l(3)neo38 | NP_001262485.1 | C2H2 Zn finger | 305..325 | CDD:275368 | 3/19 (16%) |
zf-C2H2_8 | 306..391 | CDD:292531 | 29/84 (35%) | ||
C2H2 Zn finger | 333..353 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 345..370 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 361..381 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 374..398 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 389..409 | CDD:275368 | 5/19 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 44 | 1.000 | Inparanoid score | I2683 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |