DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and hkb

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_524221.1 Gene:hkb / 40549 FlyBaseID:FBgn0261434 Length:297 Species:Drosophila melanogaster


Alignment Length:187 Identity:53/187 - (28%)
Similarity:71/187 - (37%) Gaps:47/187 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PHPHPHHVRPYPAGLHSLHAAVMGRHFGAMPTLK---------LGGAGGASGVPSGATG------ 212
            |||...|.:..|...|:...|.:.......|.|.         ...|..|:..|:...|      
  Fly    99 PHPVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAASTPTAVPGFGMDPF 163

  Fly   213 -------------------------SSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDI 252
                                     ..|||| |.|..|:..|:.:..|..|.|.||.|||:.||:
  Fly   164 TMGLMEQEYARVMAEDAQLKALNSRKQRPKK-FKCPNCDVAFSNNGQLKGHIRIHTGERPFKCDV 227

  Fly   253 --CGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEE----GP 303
              |||.|.|.:.|..|:.||:..:|:.||.|||.|.:...|..|..||:.:    ||
  Fly   228 NTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 43/138 (31%)
C2H2 Zn finger 222..242 CDD:275368 6/19 (32%)
zf-H2C2_2 234..259 CDD:290200 14/26 (54%)
C2H2 Zn finger 250..270 CDD:275368 9/21 (43%)
zf-H2C2_2 262..285 CDD:290200 10/22 (45%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-C2H2 304..326 CDD:278523 53/187 (28%)
C2H2 Zn finger 306..326 CDD:275368
hkbNP_524221.1 COG5048 195..>261 CDD:227381 28/65 (43%)
zf-C2H2 195..217 CDD:278523 7/21 (33%)
C2H2 Zn finger 197..217 CDD:275368 6/19 (32%)
zf-H2C2_2 210..236 CDD:290200 14/25 (56%)
C2H2 Zn finger 225..247 CDD:275368 9/21 (43%)
zf-H2C2_2 239..264 CDD:290200 11/24 (46%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1809
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.