| Sequence 1: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097493.1 | Gene: | dar1 / 38436 | FlyBaseID: | FBgn0263239 | Length: | 751 | Species: | Drosophila melanogaster |
| Alignment Length: | 529 | Identity: | 113/529 - (21%) |
|---|---|---|---|
| Similarity: | 154/529 - (29%) | Gaps: | 260/529 - (49%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MSSTSASPISNITVDDELNLSREQDFAEEDFIVIKEER------ETSLSPMLTPPHTPTEEPLRR 59
Fly 60 VHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHR----------------------------- 95
Fly 96 ------------LWLQMQQQQQQH--------QAPQ----------------------------- 111
Fly 112 ----------------------QYPVYP---------TASADPVAVHQQLMNHWIRNAAIYQQQQ 145
Fly 146 QQQQHPHHHHHHGHPHHPHPHPHHVRPYPAGLHSLHAAV-------------------------- 184
Fly 185 -----------MGRHFGAM---PTLKLGGAGGASGVPSGATGS--------------SRPKKQFI 221
Fly 222 ---------------------------------------------------------CKY--CNR 227
Fly 228 QFTKSYNLLIHERTHTDERPYSCD--ICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRT 290
Fly 291 LAVHKVTHL 299 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 39/172 (23%) |
| C2H2 Zn finger | 222..242 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 234..259 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 262..285 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 304..326 | CDD:278523 | |||
| C2H2 Zn finger | 306..326 | CDD:275368 | |||
| dar1 | NP_001097493.1 | COG5048 | 641..>724 | CDD:227381 | 22/82 (27%) |
| C2H2 Zn finger | 671..688 | CDD:275368 | 7/16 (44%) | ||
| zf-H2C2_2 | 680..707 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 696..718 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 710..735 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 726..746 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 67 | 1.000 | Inparanoid score | I1951 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||