DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and Osr2

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_017450351.1 Gene:Osr2 / 315039 RGDID:1305812 Length:312 Species:Rattus norvegicus


Alignment Length:277 Identity:121/277 - (43%)
Similarity:146/277 - (52%) Gaps:61/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PQQYPVYPT----------------ASADPV-------AVHQQLMNHW---------IRNAAIYQ 142
            |...|::|:                |:.|.:       ||....||||         |..:.|.:
  Rat     7 PAPIPLHPSLQLTNYSFLQAVNTFPAAVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTITE 71

  Fly   143 QQQQQ----QQHPH---------HHHHHGHPHHPHPHPHHVRPYPAGLHSLHAAVMGRH-----F 189
            ....|    .:.|.         .|...|...|..|..|..||   .....:.||....     .
  Rat    72 MAAAQGLVDARFPFPALPFATHLFHPKQGAIAHVLPALHKDRP---RFDFANLAVAATQEDPPKM 133

  Fly   190 GAMPTLKLGGAGGASGV--------PSGATGSSRPKKQFICKYCNRQFTKSYNLLIHERTHTDER 246
            |.:..|..|.....||:        ||.....|:.||:||||:|.|.||||||||||||||||||
  Rat   134 GDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRHFTKSYNLLIHERTHTDER 198

  Fly   247 PYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQR 311
            ||:||||.||||||||||||||||||:|||||.:|||||||||||||||..|::|.|||||.|.|
  Rat   199 PYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHMQESPHKCPTCGR 263

  Fly   312 SFNQRANLKSHLQSHSE 328
            :||||:|||:||.:|::
  Rat   264 TFNQRSNLKTHLLTHTD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 94/134 (70%)
C2H2 Zn finger 222..242 CDD:275368 16/19 (84%)
zf-H2C2_2 234..259 CDD:290200 22/24 (92%)
C2H2 Zn finger 250..270 CDD:275368 18/19 (95%)
zf-H2C2_2 262..285 CDD:290200 19/22 (86%)
C2H2 Zn finger 278..298 CDD:275368 16/19 (84%)
zf-C2H2 304..326 CDD:278523 15/21 (71%)
C2H2 Zn finger 306..326 CDD:275368 13/19 (68%)
Osr2XP_017450351.1 C2H2 Zn finger 174..194 CDD:275368 16/19 (84%)
zf-H2C2_2 186..211 CDD:404364 22/24 (92%)
C2H2 Zn finger 202..222 CDD:275368 18/19 (95%)
zf-H2C2_2 214..237 CDD:404364 19/22 (86%)
C2H2 Zn finger 230..250 CDD:275368 16/19 (84%)
COG5048 251..>312 CDD:227381 18/30 (60%)
C2H2 Zn finger 258..278 CDD:275368 13/19 (68%)
C2H2 Zn finger 286..306 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11040
eggNOG 1 0.900 - - E33208_3B9IA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm8926
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1664
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.870

Return to query results.
Submit another query.