DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and Klf15

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_572185.1 Gene:Klf15 / 31410 FlyBaseID:FBgn0025679 Length:311 Species:Drosophila melanogaster


Alignment Length:112 Identity:35/112 - (31%)
Similarity:50/112 - (44%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GASGVPSGATGSSRP-----------KKQFICKY--CNRQFTKSYNLLIHERTHTDERPYSCD-- 251
            |:|...|.|...:.|           ::.::|.:  |.:.:.|..:|..|.|.|..|:||.|.  
  Fly   168 GSSDSASPAEAVAPPSALQMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWP 232

  Fly   252 ICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTH 298
            .|...|.|.|.|..|:..||..||:||..|.|.|.:|..|..|:..|
  Fly   233 DCVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 34/111 (31%)
C2H2 Zn finger 222..242 CDD:275368 6/21 (29%)
zf-H2C2_2 234..259 CDD:290200 10/26 (38%)
C2H2 Zn finger 250..270 CDD:275368 7/21 (33%)
zf-H2C2_2 262..285 CDD:290200 10/22 (45%)
C2H2 Zn finger 278..298 CDD:275368 7/19 (37%)
zf-C2H2 304..326 CDD:278523
C2H2 Zn finger 306..326 CDD:275368
Klf15NP_572185.1 zf-C2H2_8 199..278 CDD:292531 29/78 (37%)
C2H2 Zn finger 203..221 CDD:275368 5/17 (29%)
C2H2 Zn finger 229..251 CDD:275368 7/21 (33%)
zf-H2C2_2 243..268 CDD:290200 11/24 (46%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.