DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and egr1

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_571323.1 Gene:egr1 / 30498 ZFINID:ZDB-GENE-980526-320 Length:511 Species:Danio rerio


Alignment Length:382 Identity:90/382 - (23%)
Similarity:134/382 - (35%) Gaps:96/382 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSTSASPISNITVDDELNLSREQDFAEEDFIVIKEERETSLSPMLTPPHTP-------------- 52
            ||||:.|.|:.:.....:||.....:|.:.|.......:|.||.:.|...|              
Zfish   148 SSTSSIPSSSSSSTSSASLSCSVHQSEPNPIYSAAPTYSSASPDIFPESGPNFSTTVGTSLQYSS 212

  Fly    53 -TEEPLRRVHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHRLWLQMQQQQQQHQAPQQYPVY 116
             |....:..:|:.|...:...|.              .|||.....:...|:..|.||.||..:.
Zfish   213 STYPSAKTCNPSFSVPMIPDYLF--------------TQQQSEISLVPPDQKPIQTQAGQQPALT 263

  Fly   117 PTASADPVAVH---QQLMNHWIRNAAIYQQQQQQQQHPHHHHHHGHPHHPHPHPHHVRPYPAGLH 178
            |..:....|..   |.|       .::||.|..:......     :|:.|...|.|.|||     
Zfish   264 PLHTIKAFATQTGSQDL-------KSVYQSQLIKPSRMRK-----YPNRPSKTPPHERPY----- 311

  Fly   179 SLHAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSRPKKQFICKYCNRQFTKSYNLLIHERTHT 243
                        |.|.                            :.|:|:|::|..|..|.|.||
Zfish   312 ------------ACPV----------------------------ETCDRRFSRSDELTRHIRIHT 336

  Fly   244 DERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPI 308
            .::|:.|.||.:.|.|.|||..|...|:.:|||.|..||:.|.:|.....|...|:.:...|.  
Zfish   337 GQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQKDKKA-- 399

  Fly   309 CQRSFNQRANLKSHLQSHSEQSTKEVVVTTSPATSHSVPNQALSSPQPENLAQHLPV 365
               .....|.::|.:.:.|..::..|....||.||:  |:...|.|.|.|.....||
Zfish   400 ---EKGATAAVQSSVSNISISASSPVSSYPSPITSY--PSPVSSFPSPVNSCYSSPV 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 34/130 (26%)
C2H2 Zn finger 222..242 CDD:275368 7/19 (37%)
zf-H2C2_2 234..259 CDD:290200 10/24 (42%)
C2H2 Zn finger 250..270 CDD:275368 9/19 (47%)
zf-H2C2_2 262..285 CDD:290200 10/22 (45%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-C2H2 304..326 CDD:278523 3/21 (14%)
C2H2 Zn finger 306..326 CDD:275368 2/19 (11%)
egr1NP_571323.1 DUF3446 99..185 CDD:288757 10/36 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..169 8/20 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..312 7/42 (17%)
zf-C2H2 311..335 CDD:278523 10/68 (15%)
C2H2 Zn finger 313..335 CDD:275368 8/49 (16%)
zf-H2C2_2 327..352 CDD:290200 10/24 (42%)
C2H2 Zn finger 343..363 CDD:275368 9/19 (47%)
zf-H2C2_2 355..380 CDD:290200 11/24 (46%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 384..406 3/26 (12%)
DUF3432 403..498 CDD:288743 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.