DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and prz1

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_593073.1 Gene:prz1 / 2541806 PomBaseID:SPAC4G8.13c Length:681 Species:Schizosaccharomyces pombe


Alignment Length:418 Identity:92/418 - (22%)
Similarity:140/418 - (33%) Gaps:123/418 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TSASP-ISNITVD---DELNLSREQDF----AEEDFIVIKE---ERETSLSPMLTPPHTPT---- 53
            |:||| .||..:|   |..||:...|.    :...||....   |.....||.|.|....|    
pombe   294 TNASPGESNTGIDFDTDNTNLNPSVDLLSNHSTPSFIFENSPSAEFSHQSSPYLVPNSGRTLNSE 358

  Fly    54 ---EEPLRRVHPAISEEAVATQL--HM----------RHMAHYQQQQQQQQQQQQHRLWLQMQQQ 103
               |..:|.|:...||:.....|  |:          ..:.:|.........|..     .:...
pombe   359 NARESTIRSVNSPFSEDHADASLTTHVFDPISPTALSNSVLNYDSNNFSGTPQIN-----VVPSS 418

  Fly   104 QQQHQAPQQYPVYP----------TASADPVAVHQQLMN---HWIRNAAIYQQQQQQQQHPHHHH 155
            ..:.|:....|..|          :.||.||: .|..||   :.::||.:...:........|..
pombe   419 PSKSQSGPSLPANPLLQTDISITYSQSASPVS-GQPAMNENSYDLQNANLCAPEMSPTYTARHRS 482

  Fly   156 HHG-------------HPHHPHPHP---------------------------HHVRPYPAGLHSL 180
            :..             :.|..|...                           .:.||....|:||
pombe   483 NSAGSRFDAYEPIPQLYTHFSHSSECLSVNQDTELLGKIENDNSKSNDYLSVRNTRPRSRSLNSL 547

  Fly   181 HAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSRPKKQ--FICKY--CNRQFTKSYNLLIHERT 241
                               .|..|...|.:...|..|.|  ::|.:  ||::||::|||..|..|
pombe   548 -------------------VGNKSENSSSSKAKSESKSQGNYVCTFAGCNKRFTRAYNLKSHMNT 593

  Fly   242 HTDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKC 306
            ||:.||:.|.||.|:|.||...|.|..:|:..|.|.|..|.:.|.:...|..|..:.:.:.    
pombe   594 HTNYRPFQCSICKKSFARQHDKRRHEQLHTGIKAFACVTCNQRFARMDALNRHYKSEVGQN---- 654

  Fly   307 PICQRSFNQRA-----NLKSHLQSHSEQ 329
              |.|:..:|.     :.|:.:.|.|:|
pombe   655 --CLRTATERGIQVPPSRKTAVASTSKQ 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 43/136 (32%)
C2H2 Zn finger 222..242 CDD:275368 9/21 (43%)
zf-H2C2_2 234..259 CDD:290200 13/24 (54%)
C2H2 Zn finger 250..270 CDD:275368 9/19 (47%)
zf-H2C2_2 262..285 CDD:290200 7/22 (32%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
zf-C2H2 304..326 CDD:278523 4/26 (15%)
C2H2 Zn finger 306..326 CDD:275368 4/24 (17%)
prz1NP_593073.1 COG5048 121..620 CDD:227381 77/350 (22%)
zf-C2H2 570..594 CDD:278523 9/23 (39%)
C2H2 Zn finger 577..594 CDD:275368 8/16 (50%)
zf-H2C2_2 586..611 CDD:290200 13/24 (54%)
C2H2 Zn finger 602..622 CDD:275368 9/19 (47%)
zf-H2C2_2 616..639 CDD:290200 8/22 (36%)
C2H2 Zn finger 630..648 CDD:275368 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.