DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and Osr1

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_035989.1 Gene:Osr1 / 23967 MGIID:1344424 Length:266 Species:Mus musculus


Alignment Length:265 Identity:101/265 - (38%)
Similarity:117/265 - (44%) Gaps:88/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PVAVHQQLMNHWIRNAAIYQQQQQQQQHPHHH-------------HHH----GHP--HHPHP--- 165
            ||.:|..|.   :.|.:..|........|..|             |.|    |:|  |.|..   
Mouse     9 PVPIHPSLQ---LTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFS 70

  Fly   166 ---------------------HPHHVRPYPAGLHSLHAAVMGRHFGAMPTLKLG----------- 198
                                 .||.:.|.|    .:.|...|......|.....           
Mouse    71 KVPGAVSSLMDARFQLPAFPWFPHVIHPKP----EITAGGSGAALKTKPRFDFANLALAATQEDP 131

  Fly   199 ---GAGGASGVPSGATGS-------------------SRPKKQFICKYCNRQFTKSYNLLIHERT 241
               |.|...|.|:|..|:                   |:.||:|:||:|.|.|||||||||||||
Mouse   132 TKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERT 196

  Fly   242 HTDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTH-----LEE 301
            |||||||:||||.||||||||||||||||||:|||||.:|||||||||||||||..|     |:.
Mouse   197 HTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKT 261

  Fly   302 GPHKC 306
            ...||
Mouse   262 SKIKC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 78/128 (61%)
C2H2 Zn finger 222..242 CDD:275368 16/19 (84%)
zf-H2C2_2 234..259 CDD:290200 22/24 (92%)
C2H2 Zn finger 250..270 CDD:275368 18/19 (95%)
zf-H2C2_2 262..285 CDD:290200 19/22 (86%)
C2H2 Zn finger 278..298 CDD:275368 16/19 (84%)
zf-C2H2 304..326 CDD:278523 2/3 (67%)
C2H2 Zn finger 306..326 CDD:275368 1/1 (100%)
Osr1NP_035989.1 zf-C2H2 175..197 CDD:395048 17/21 (81%)
C2H2 Zn finger 177..197 CDD:275368 16/19 (84%)
zf-H2C2_2 189..214 CDD:404364 22/24 (92%)
C2H2 Zn finger 205..225 CDD:275368 18/19 (95%)
zf-H2C2_2 217..240 CDD:404364 19/22 (86%)
C2H2 Zn finger 233..253 CDD:275368 16/19 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11278
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2594
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 1 1.000 - - X1664
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.950

Return to query results.
Submit another query.