DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and Klf11

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_848134.1 Gene:Klf11 / 194655 MGIID:2653368 Length:502 Species:Mus musculus


Alignment Length:154 Identity:41/154 - (26%)
Similarity:66/154 - (42%) Gaps:41/154 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 KKQFICKY--CNRQFTKSYNLLIHERTHTDERPYSC--DICGKAFRRQDHLRDHRYIHSKDKPFK 277
            ::.::|.:  |.:.:.||.:|..|.||||.|:|::|  |.|.|.|.|.|.|..||..|:.:|.| 
Mouse   381 RRNYVCNFPGCRKTYFKSSHLKAHLRTHTGEKPFTCSWDGCDKKFARSDELSRHRRTHTGEKKF- 444

  Fly   278 CSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTKEVVVTTSPAT 342
                                       .||:|.|.|.:..:|..|.:.|  .:||::     |..
Mouse   445 ---------------------------VCPVCDRRFMRSDHLTKHARRH--MTTKKI-----PGW 475

  Fly   343 SHSVP--NQALSSPQPENLAQHLP 364
            ...|.  |:...:..|.::.:.||
Mouse   476 QAEVGKLNRITLAESPGSILEPLP 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 35/120 (29%)
C2H2 Zn finger 222..242 CDD:275368 7/21 (33%)
zf-H2C2_2 234..259 CDD:290200 13/26 (50%)
C2H2 Zn finger 250..270 CDD:275368 10/21 (48%)
zf-H2C2_2 262..285 CDD:290200 6/22 (27%)
C2H2 Zn finger 278..298 CDD:275368 0/19 (0%)
zf-C2H2 304..326 CDD:278523 7/21 (33%)
C2H2 Zn finger 306..326 CDD:275368 7/19 (37%)
Klf11NP_848134.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..194
COG5048 382..>439 CDD:227381 22/56 (39%)
zf-C2H2 384..408 CDD:278523 7/23 (30%)
C2H2 Zn finger 389..408 CDD:275368 6/18 (33%)
zf-H2C2_2 400..427 CDD:290200 13/26 (50%)
C2H2 Zn finger 416..438 CDD:275368 10/21 (48%)
zf-H2C2_2 430..453 CDD:290200 10/50 (20%)
zf-C2H2 444..466 CDD:278523 8/49 (16%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.