DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and odd-2

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_509032.1 Gene:odd-2 / 183219 WormBaseID:WBGene00003846 Length:254 Species:Caenorhabditis elegans


Alignment Length:238 Identity:96/238 - (40%)
Similarity:117/238 - (49%) Gaps:77/238 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QQQQQQHRLWLQMQQQQQQHQAPQQ-------YPVYP------------TASADPVAVHQQL--- 130
            |..:|..|:.|..|..|.|:...|:       .|..|            |..||.:...|::   
 Worm    15 QSNEQVFRMMLAQQHLQLQNFLQQRKMALLAMNPEIPMITDLKKAKFDFTHMADSIESEQKIKEE 79

  Fly   131 -----MNHWIRNAAIYQQQQQQQQHPHHHHHHGHPHHPHPHPHHVRPYPAGLHSLHAAVMGRHFG 190
                 |:..:..||:                  .|..|:..|..:.|                  
 Worm    80 SVSPKMSPTLTTAAV------------------RPFVPYDQPWFMIP------------------ 108

  Fly   191 AMPTLKLGGAGGASGVPSGATGSSRPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGK 255
                    |.|..:|      .::||||:||||||:|.|||||||||||||||||||||||:|||
 Worm   109 --------GRGRTTG------RAARPKKEFICKYCDRHFTKSYNLLIHERTHTDERPYSCDVCGK 159

  Fly   256 AFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTH 298
            |||||||||||:|||.||:||||..|||||||||||.||:.||
 Worm   160 AFRRQDHLRDHKYIHQKDRPFKCEICGKGFCQSRTLLVHRATH 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 73/96 (76%)
C2H2 Zn finger 222..242 CDD:275368 17/19 (89%)
zf-H2C2_2 234..259 CDD:290200 23/24 (96%)
C2H2 Zn finger 250..270 CDD:275368 17/19 (89%)
zf-H2C2_2 262..285 CDD:290200 17/22 (77%)
C2H2 Zn finger 278..298 CDD:275368 14/19 (74%)
zf-C2H2 304..326 CDD:278523
C2H2 Zn finger 306..326 CDD:275368
odd-2NP_509032.1 zf-C2H2 124..146 CDD:278523 19/21 (90%)
C2H2 Zn finger 126..146 CDD:275368 17/19 (89%)
zf-H2C2_2 138..163 CDD:290200 23/24 (96%)
C2H2 Zn finger 154..174 CDD:275368 17/19 (89%)
zf-H2C2_2 166..189 CDD:290200 17/22 (77%)
zf-C2H2 180..202 CDD:278523 16/21 (76%)
C2H2 Zn finger 182..202 CDD:275368 14/19 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I7321
eggNOG 1 0.900 - - E33208_3B9IA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2594
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm4817
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 1 1.000 - - X1664
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.