DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and odd-1

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_498552.2 Gene:odd-1 / 181893 WormBaseID:WBGene00003845 Length:242 Species:Caenorhabditis elegans


Alignment Length:258 Identity:91/258 - (35%)
Similarity:122/258 - (47%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PPHTPTEEPLRRVHPAISEEAVATQLHMRHMAHYQQQQQQQQQQQQHRL--WLQMQQQQQQHQAP 110
            ||..|:.|.:.|:..| .::.:|.|..:      |.|.::|.....|.|  ||            
 Worm    14 PPVVPSVEDIIRMLVA-GQQKIAIQNLL------QSQSKEQVNGTSHDLQNWL------------ 59

  Fly   111 QQYPVYPTASADPVAVHQQLMNHWIRNAAIYQQQQQQQQHPHHHHHHGHPHHPHPHPHHVRPYPA 175
            ....:.|::|..|.......:...:.|..:...|.|.|.    ..:.|.|...:|..|       
 Worm    60 TSLCISPSSSPTPSNASTSTIPAQMTNENVLHLQIQSQL----FSNLGTPWFLNPEQH------- 113

  Fly   176 GLHSLHAAVMGRHFGAMPTLKLGGAGGASGVPSGATGSSRPKKQFICKYCNRQFTKSYNLLIHER 240
              :..:.|:                            ..||||:||||||.|.|||||||:||||
 Worm   114 --NKTNNAI----------------------------RKRPKKEFICKYCARHFTKSYNLMIHER 148

  Fly   241 THTDERPYSCDICGKAFRRQDHLRDHRYIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGP 303
            |||:|||:.|:.|||:||||||||||:|||:|:||.||..|||||||.|||.||:..|..:.|
 Worm   149 THTNERPFHCETCGKSFRRQDHLRDHKYIHAKEKPHKCEICGKGFCQLRTLNVHRSCHHVQEP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 64/101 (63%)
C2H2 Zn finger 222..242 CDD:275368 16/19 (84%)
zf-H2C2_2 234..259 CDD:290200 17/24 (71%)
C2H2 Zn finger 250..270 CDD:275368 15/19 (79%)
zf-H2C2_2 262..285 CDD:290200 16/22 (73%)
C2H2 Zn finger 278..298 CDD:275368 13/19 (68%)
zf-C2H2 304..326 CDD:278523 91/258 (35%)
C2H2 Zn finger 306..326 CDD:275368
odd-1NP_498552.2 C2H2 Zn finger 130..150 CDD:275368 16/19 (84%)
zf-H2C2_2 142..167 CDD:290200 17/24 (71%)
C2H2 Zn finger 158..178 CDD:275368 15/19 (79%)
zf-H2C2_2 170..193 CDD:290200 16/22 (73%)
C2H2 Zn finger 186..206 CDD:275368 13/19 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7667
eggNOG 1 0.900 - - E33208_3B9IA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000748
OrthoInspector 1 1.000 - - mtm4817
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14196
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.900

Return to query results.
Submit another query.