DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sob and ZBTB2

DIOPT Version :9

Sequence 1:NP_476882.1 Gene:sob / 33581 FlyBaseID:FBgn0004892 Length:578 Species:Drosophila melanogaster
Sequence 2:NP_065912.1 Gene:ZBTB2 / 57621 HGNCID:20868 Length:514 Species:Homo sapiens


Alignment Length:473 Identity:107/473 - (22%)
Similarity:163/473 - (34%) Gaps:157/473 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SLQGTMVSSLQQAALLPANSAAAAALNL----QALESYLALQRLTGKSDVFRFSNSNTGSSNSNN 193
            ||.|..::..|   |..|...|:|...|    :...|.::.:::...|.:.:.: ||....|..|
Human   131 SLYGIQIADHQ---LRQATKIASAPEKLGRDPRPQTSRISQEQVPEASQLSQLT-SNLAQVNRTN 191

  Fly   194 ATTCNSSSSEADNNALPSLI----------DIANIELKSSCSSSSSGEPPLTAATASAAATSSPS 248
            .|    .|.....:..|.|:          :..|:|      :|||.|.|.:...|..    .||
Human   192 MT----PSDPLQTSLSPELVSTPVPPPPPGEETNLE------ASSSDEQPASLTIAHV----KPS 242

  Fly   249 SNNSNSTSTPTTSKC----------------------VPLPSIGTVSAAVAAAAAAAAAAASQQA 291
            ....|. |.|....|                      ||..|                   |||.
Human   243 IMKRNG-SFPKYYACHLCGRRFTLRSSLREHLQIHTGVPFTS-------------------SQQG 287

  Fly   292 ALD-----CATAAELAAECDLPLLDGEDALSF-EAGDL-DSSYGSFMFNPSAFSQAETDSALHSL 349
            ...     |:.||:|          |:||:.. |||.: ||.......:|....|.::::...| 
Human   288 ESRVPLTLCSNAADL----------GKDAMEVPEAGMISDSELQHISDSPIIDGQQQSETPPPS- 341

  Fly   350 QATMYQDKMSVISGAAGGVGAGAVGGLEEAGSSAAAAAAQRSKKQFICKFCNRQFTKSYNLLIHE 414
                               ....:..||:|..       :|..|:                    
Human   342 -------------------DIADIDNLEQADQ-------EREVKR-------------------- 360

  Fly   415 RTHTDERPYSCDICGKAFRRQDHLRDHRYIHSKEKPFKCAECGKGFCQSRTLAVHKILHMEESPH 479
                  |.|.|.|||:.|.::.|.|:|.|||: .|||||:.|.|.||::...|.|..|:.....:
Human   361 ------RKYECTICGRKFIQKSHWREHMYIHT-GKPFKCSTCDKSFCRANQAARHVCLNQSIDTY 418

  Fly   480 ------KCPVCNRSFNQRSNLKTHLLTHTDIKPYNCASCGKVFRRNCDLRRHSLTHNLSAGVGGV 538
                  ...:|  :|.:.|.: .::|..|: |||.|..|.|.|....::.:|| ..|.::.|..:
Human   419 TMVDKQTLELC--TFEEGSQM-DNMLVQTN-KPYKCNLCDKTFSTPNEVVKHS-CQNQNSDVFAL 478

  Fly   539 VGGNLSDPFGSGSSSSSE 556
            ..|. |...|||.|..:|
Human   479 DEGR-SILLGSGDSEVTE 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sobNP_476882.1 COG5048 <389..529 CDD:227381 41/145 (28%)
C2H2 Zn finger 397..417 CDD:275368 0/19 (0%)
zf-H2C2_2 409..434 CDD:290200 7/24 (29%)
C2H2 Zn finger 425..445 CDD:275368 9/19 (47%)
zf-H2C2_2 437..460 CDD:290200 13/22 (59%)
C2H2 Zn finger 453..473 CDD:275368 7/19 (37%)
zf-C2H2 479..501 CDD:278523 4/27 (15%)
C2H2 Zn finger 481..501 CDD:275368 4/19 (21%)
zf-H2C2_2 493..518 CDD:290200 9/24 (38%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
ZBTB2NP_065912.1 BTB 14..>84 CDD:306997
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..231 19/92 (21%)
C2H2 Zn finger 256..276 CDD:275368 1/19 (5%)
zf-C2H2 363..385 CDD:306579 10/21 (48%)
C2H2 Zn finger 365..385 CDD:275368 9/19 (47%)
zf-H2C2_2 377..399 CDD:316026 13/22 (59%)
C2H2 Zn finger 392..443 CDD:275368 12/53 (23%)
C2H2 Zn finger 450..466 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5238
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.